PDB entry 1ekg

View 1ekg on RCSB PDB site
Description: mature human frataxin
Class: metal transport
Keywords: Freidreich's ataxia, iron transport, mitochondrial, disease, METAL TRANSPORT
Deposited on 2000-03-08, released 2000-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: frataxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ekgA (A:)
    gshmgsldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgty
    vinkqtpnkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlssl
    aysgkda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekgA (A:)
    ldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkqt
    pnkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgk