PDB entry 1eke

View 1eke on RCSB PDB site
Description: crystal structure of class II ribonuclease h (RNAse hii) with mes ligand
Class: hydrolase
Keywords: Nuclease, Endonuclease, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2000-03-07, released 2000-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hii
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57599 (0-End)
      • modified residue (0)
      • modified residue (17)
      • modified residue (75)
    Domains in SCOPe 2.06: d1ekea_
  • Chain 'B':
    Compound: ribonuclease hii
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57599 (0-End)
      • modified residue (0)
      • modified residue (17)
      • modified residue (75)
    Domains in SCOPe 2.06: d1ekeb_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ekeA (A:)
    miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
    yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
    fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
    gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqtkliie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekeA (A:)
    miiigideagrgpvlgpmvvcafaiekereeelkklgvkeltknkraylkkllenlgyve
    krileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkkfed
    sfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdigsg
    ypsdpktikfledyfkkhkklpdiarthwktckrildkskqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ekeB (B:)
    miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
    yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
    fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
    gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqtkliie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekeB (B:)
    miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
    yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
    fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
    gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqt