PDB entry 1eke

View 1eke on RCSB PDB site
Description: crystal structure of class ii ribonuclease h (rnase hii) with mes ligand
Deposited on 2000-03-07, released 2000-09-13
The last revision prior to the SCOP 1.61 freeze date was dated 2000-09-13, with a file datestamp of 2000-09-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ekea_
  • Chain 'B':
    Domains in SCOP 1.61: d1ekeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ekeA (A:)
    miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
    yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
    fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
    gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekeA (A:)
    miiigideagrgpvlgpmvvcafaiekereeelkklgvkeltknkraylkkllenlgyve
    krileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkkfed
    sfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdigsg
    ypsdpktikfledyfkkhkklpdiarthwktckrildkskqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekeB (B:)
    miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
    yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
    fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
    gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqt