PDB entry 1ekc

View 1ekc on RCSB PDB site
Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna
Deposited on 2000-03-07, released 2000-04-17
The last revision was dated 2000-10-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.266
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80378 (1-88)
      • conflict (80-82)
      • conflict (87)
  • Chain 'C':
    Compound: 30S ribosomal protein S18
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • gb AAF27297
  • Chain 'D':
    Compound: 16S ribosomal RNA
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: 16S ribosomal RNA
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80378 (1-88)
      • conflict (80-82)
      • conflict (87)
  • Chain 'H':
    Compound: 30S ribosomal protein S18
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • gb AAF27297
  • Chain 'I':
    Compound: 16S ribosomal RNA
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: 16S ribosomal RNA
    Species: synthetic, synthetic

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ekcA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ekcB (B:)
    mpitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyreiveklglrg
    

    Sequence, based on observed residues (ATOM records):
    >1ekcB (B:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyreiveklglrg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1ekcC (C:)
    mstknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsg
    keqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records):
    >1ekcC (C:)
    rnvevlkrflsetgkilprrrtglsgkeqrilaktikrarilgllpftek
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >1ekcF (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1ekcG (G:)
    mpitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyreiveklglrg
    

    Sequence, based on observed residues (ATOM records):
    >1ekcG (G:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyreiveklglrg
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1ekcH (H:)
    mstknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsg
    keqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records):
    >1ekcH (H:)
    rnvevlkrflsetgkilprrrtglsgkeqrilaktikrarilgllpftek
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.