PDB entry 1ekb

View 1ekb on RCSB PDB site
Description: the serine protease domain of enteropeptidase bound to inhibitor val-asp-asp-asp-asp-lys-chloromethane
Class: hydrolase/hydrolase inhibitor
Keywords: enteropeptidase, trypsinogen activation, hydrolase-hydrolase inhibitor complex
Deposited on 1999-05-02, released 1999-10-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.234
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enteropeptidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: enteropeptidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ekbb_
  • Chain 'C':
    Compound: val-asp-asp-asp-asp-lyk peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1EKB (2-6)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekbB (B:)
    ivggsdsregawpwvvalyfddqqvcgaslvsrdwlvsaahcvygrnmepskwkavlglh
    masnltspqietrlidqivinphynkrrknndiammhlemkvnytdyiqpiclpeenqvf
    ppgricsiagwgaliyqgstadvlqeadvpllsnekcqqqmpeynitenmvcagyeaggv
    dscqgdsggplmcqennrwllagvtsfgyqcalpnrpgvyarvprftewiqsflh
    

  • Chain 'C':
    No sequence available.