PDB entry 1ek8

View 1ek8 on RCSB PDB site
Description: crystal structure of the ribosome recycling factor (rrf) from escherichia coli
Class: translation
Keywords: ribosome, translation factor, t-RNA mimicry, coiled coil
Deposited on 2000-03-07, released 2001-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome recycling factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ek8a_
  • Heterogens: HG, DEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ek8A (A:)
    misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
    dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
    aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
    elmqf