PDB entry 1ek6

View 1ek6 on RCSB PDB site
Description: structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose
Class: isomerase
Keywords: Epimerase, Short-Chain Dehydrogenase, Galactosemia, ISOMERASE
Deposited on 2000-03-06, released 2000-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactose 4-epimerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14376 (0-End)
      • see remark 999 (179)
    Domains in SCOPe 2.07: d1ek6a_
  • Chain 'B':
    Compound: udp-galactose 4-epimerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14376
      • see remark 999 (179)
    Domains in SCOPe 2.07: d1ek6b_
  • Heterogens: MG, NAI, UPG, TMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ek6A (A:)
    maekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsv
    efeemdildqgalqrlfkkysfmavihfaglkavgesvqkpldyyrvnltgtiqlleimk
    ahgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwna
    vllryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrd
    yihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarr
    egdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgtqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ek6A (A:)
    maekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsv
    efeemdildqgalqrlfkkysfmavihfaglkavgesvqkpldyyrvnltgtiqlleimk
    ahgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwna
    vllryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrd
    yihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarr
    egdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ek6B (B:)
    maekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsv
    efeemdildqgalqrlfkkysfmavihfaglkavgesvqkpldyyrvnltgtiqlleimk
    ahgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwna
    vllryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrd
    yihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarr
    egdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgtqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ek6B (B:)
    aekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsve
    feemdildqgalqrlfkkysfmavihfaglkavgesvqkpldyyrvnltgtiqlleimka
    hgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwnav
    llryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrdy
    ihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarre
    gdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgt