PDB entry 1ek3

View 1ek3 on RCSB PDB site
Description: kappa-4 immunoglobulin vl, rec
Deposited on 2000-03-06, released 2001-03-06
The last revision prior to the SCOP 1.65 freeze date was dated 2001-03-06, with a file datestamp of 2001-03-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ek3a_
  • Chain 'B':
    Domains in SCOP 1.65: d1ek3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ek3A (A:)
divmtqspdslavspgeratinckssqnlldssfdtntlawyqqkpgqppklliywassr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgggtkveikr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ek3B (B:)
divmtqspdslavspgeratinckssqnlldssfdtntlawyqqkpgqppklliywassr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgggtkveikr