PDB entry 1ek3

View 1ek3 on RCSB PDB site
Description: kappa-4 immunoglobulin vl, rec
Class: immune system
Keywords: Human Immunoglobulin Light Chain VL, Amyloid protein, flipped-dimer, IMMUNE SYSTEM
Deposited on 2000-03-06, released 2001-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kappa-4 immunoglobulin light chain vl
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625
      • see remark 999 (14)
      • see remark 999 (26)
      • see remark 999 (26)
      • see remark 999 (26)
      • see remark 999 (33-35)
      • see remark 999 (37)
      • see remark 999 (58)
      • see remark 999 (101-102)
      • see remark 999 (105)
      • see remark 999 (109)
    Domains in SCOPe 2.07: d1ek3a_
  • Chain 'B':
    Compound: kappa-4 immunoglobulin light chain vl
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625 (0-113)
      • see remark 999 (14)
      • see remark 999 (26)
      • see remark 999 (26)
      • see remark 999 (26)
      • see remark 999 (33-35)
      • see remark 999 (37)
      • see remark 999 (58)
      • see remark 999 (101-102)
      • see remark 999 (105)
      • see remark 999 (109)
    Domains in SCOPe 2.07: d1ek3b_
  • Heterogens: CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ek3A (A:)
    divmtqspdslavspgeratinckssqnlldssfdtntlawyqqkpgqppklliywassr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgggtkveikr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ek3B (B:)
    divmtqspdslavspgeratinckssqnlldssfdtntlawyqqkpgqppklliywassr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgggtkveikr