PDB entry 1ek2

View 1ek2 on RCSB PDB site
Description: crystal structure of murine soluble epoxide hydrolase complexed with cdu inhibitor
Deposited on 2000-03-06, released 2000-05-31
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.211
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ek2A (A:)
    rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
    vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
    nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
    ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvshgyvtvk
    pgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygdsssppei
    eeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravaslntpfmpp
    dpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfiavhkate
    iggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsckglgrki
    lvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqilikwlqt
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ek2A (A:)
    rvaafdldgvlalpsigpteqlmkgkitfsqwqifsqamaarsinrpmlqaaialkkkgf
    ttcivtnnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakp
    nevvflddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvsh
    gyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygds
    ssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravasln
    tpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfia
    vhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsck
    glgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqil
    ikwlqte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ek2B (B:)
    rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
    vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
    nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
    ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvshgyvtvk
    pgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygdsssppei
    eeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravaslntpfmpp
    dpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfiavhkate
    iggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsckglgrki
    lvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqilikwlqt
    e