PDB entry 1ek2

View 1ek2 on RCSB PDB site
Description: crystal structure of murine soluble epoxide hydrolase complexed with cdu inhibitor
Class: hydrolase
Keywords: homodimer, alpha/beta hydrolase fold, disubstituted urea inhibitor
Deposited on 2000-03-06, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.211
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epoxide hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ek2a1, d1ek2a2
  • Chain 'B':
    Compound: epoxide hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ek2b1, d1ek2b2
  • Heterogens: CDU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ek2A (A:)
    malrvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitf
    sqwvplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttc
    ivtnnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnev
    vflddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvshgyv
    tvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygdsssp
    peieeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravaslntpf
    mppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfiavhk
    ateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsckglg
    rkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqilikw
    lqtevqnpsvtski
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ek2A (A:)
    rvaafdldgvlalpsigpteqlmkgkitfsqwqifsqamaarsinrpmlqaaialkkkgf
    ttcivtnnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakp
    nevvflddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvsh
    gyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygds
    ssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravasln
    tpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfia
    vhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsck
    glgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqil
    ikwlqte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ek2B (B:)
    malrvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitf
    sqwvplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttc
    ivtnnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnev
    vflddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvshgyv
    tvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygdsssp
    peieeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravaslntpf
    mppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfiavhk
    ateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsckglg
    rkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqilikw
    lqtevqnpsvtski
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ek2B (B:)
    rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
    vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
    nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
    ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvshgyvtvk
    pgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygdsssppei
    eeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravaslntpfmpp
    dpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfiavhkate
    iggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsckglgrki
    lvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqilikwlqt
    e