PDB entry 1ek1

View 1ek1 on RCSB PDB site
Description: crystal structure of murine soluble epoxide hydrolase complexed with ciu inhibitor
Deposited on 2000-03-06, released 2000-05-31
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-27, with a file datestamp of 2001-06-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ek1A (A:)
    rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
    vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
    nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
    ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvshgyvtvk
    pgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygdsssppei
    eeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravaslntpfmpp
    dpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfiavhkate
    iggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsckglgrki
    lvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqilikwlqt
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ek1A (A:)
    rvaafdldgvlalpsigpteqlmkgkitfsqwvplqifsqamaarsinrpmlqaaialkk
    kgfttcivtnnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlk
    akpnevvflddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpnd
    vshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgy
    gdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervrava
    slntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetg
    fiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkw
    sckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevn
    qilikwlqte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ek1B (B:)
    rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
    vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
    nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
    ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvshgyvtvk
    pgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygdsssppei
    eeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravaslntpfmpp
    dpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfiavhkate
    iggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsckglgrki
    lvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqilikwlqt
    e