PDB entry 1ek0

View 1ek0 on RCSB PDB site
Description: gppnhp-bound ypt51 at 1.48 a resolution
Class: endocytosis/exocytosis
Keywords: g protein, vesicular traffic, GTP hydrolysis, ypt/rab protein, endocytosis, hydrolase, endocytosis/exocytosis complex
Deposited on 2000-03-06, released 2000-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.179
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (GTP-binding protein ypt51)
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36017 (0-169)
    • modified residue (70)
    • modified residue (119)
  Domains in SCOPe 2.05: d1ek0a_
• Heterogens: MG, NI, GNP, GDP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ek0A (A:)
  vtsiklvllgeaavgkssivlrfvsndfaenkeptigaafltqrvtinehtvkfeiwdta
  gqerfaslapmyyrnaqaalvvydvtkpqsfikarhwvkelheqaskdiiialvgnkidm
  lqeggerkvareegeklaeekgllffetsaktgenvndvflgigekiplk