PDB entry 1ejx

View 1ejx on RCSB PDB site
Description: crystal structure of wild-type klebsiella aerogenes urease at 100k
Deposited on 2000-03-04, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejxA (A:)
    meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
    rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejxB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ejxC (C:)
    msnisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqm
    laadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaatevia
    aegkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrm
    lqaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademd
    iqvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnp
    tlpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssd
    sqamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahe
    vgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgal
    gsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt
    yevrvdgelitsepadvlpmaqryflf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejxC (C:)
    snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
    aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
    egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
    qaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdi
    qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
    lpytlntidehldmlmvcvafaesrirretiaaedvlhdlgafsltssdsqamgrvgevi
    lrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgsievgklad
    lvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltf
    lsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelit
    sepadvlpmaqryflf