PDB entry 1ejs

View 1ejs on RCSB PDB site
Description: Crystal Structure of the H219N Variant of Klebsiella Aerogenes Urease
Class: hydrolase
Keywords: alpha-beta barrel, nickel metalloenzyme, HYDROLASE
Deposited on 2000-03-04, released 2000-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease gamma subunit
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejsa_
  • Chain 'B':
    Compound: urease beta subunit
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejsb_
  • Chain 'C':
    Compound: urease alpha subunit
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18314 (Start-566)
      • modified residue (216)
      • engineered (218)
    Domains in SCOPe 2.07: d1ejsc1, d1ejsc2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejsA (A:)
    meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
    rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejsB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ejsC (C:)
    msnisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqm
    laadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaatevia
    aegkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrm
    lqaadslpvnigllgkgnvsqpdalreqvaagviglkinedwgatpaaidcaltvademd
    iqvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnp
    tlpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssd
    sqamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahe
    vgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgal
    gsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt
    yevrvdgelitsepadvlpmaqryflf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejsC (C:)
    snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
    aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
    egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
    qaadslpvnigllgkgnvsqpdalreqvaagviglkinedwgatpaaidcaltvademdi
    qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
    lpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssds
    qamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahev
    gsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalg
    sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
    evrvdgelitsepadvlpmaqryflf