PDB entry 1ejo

View 1ejo on RCSB PDB site
Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g-h loop from fmdv.
Class: immune system
Keywords: FMDV, antigenic-antibody interactions, RGD motif, G-H loop of VP1.
Deposited on 2000-03-03, released 2000-03-17
The last revision prior to the SCOP 1.75 freeze date was dated 2000-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.248
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a monoclonal antibody (heavy chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1ejoh1, d1ejoh2
  • Chain 'L':
    Compound: igg2a monoclonal antibody (light chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1ejol1, d1ejol2
  • Chain 'P':
    Compound: fmdv peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAA42624 (0-End)
      • conflict (11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ejoH (H:)
    eqmlvesggdlvkpggslklscaasgftfssytmswvrqtpekrlewvatissggaytyy
    pdsvkgrftisddnaestlylqmsslrsedtamyycvrrafdsdvgfaswghrtlvtvsa
    akttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejoH (H:)
    qmlvesggdlvkpggslklscaasgftfssytmswvrqtpekrlewvatissggaytyyp
    dsvkgrftisddnaestlylqmsslrsedtamyycvrrafdsdvgfaswghrtlvtvsaa
    kttapsvyplapvcgsvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejoL (L:)
    divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnra
    

  • Chain 'P':
    No sequence available.