PDB entry 1ejm

View 1ejm on RCSB PDB site
Description: crystal structure of the bpti ala16leu mutant in complex with bovine trypsin
Class: hydrolase/inhibitor
Keywords: Complex, HYDROLASE/INHIBITOR COMPLEX
Deposited on 2000-03-03, released 2001-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.211
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ejma_
  • Chain 'B':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered (14-15)
      • engineered (51)
    Domains in SCOPe 2.06: d1ejmb_
  • Chain 'C':
    Compound: beta-trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ejmc_
  • Chain 'D':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered (14-15)
      • engineered (51)
    Domains in SCOPe 2.06: d1ejmd_
  • Chain 'E':
    Compound: beta-trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ejme_
  • Chain 'F':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered (14-15)
      • engineered (51)
    Domains in SCOPe 2.06: d1ejmf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejmA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejmB (B:)
    rpdfcleppytgpcrlriiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejmC (C:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejmD (D:)
    rpdfcleppytgpcrlriiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejmE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejmF (F:)
    rpdfcleppytgpcrlriiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga