PDB entry 1ejk

View 1ejk on RCSB PDB site
Description: solution structure of the dini protein
Class: protein binding
Keywords: alpha and beta, PROTEIN BINDING
Deposited on 2000-03-02, released 2000-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dini protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejkA (A:)
    mrievtiaktsplpagaidalagelsrriqyafpdneghvsvryaaannlsvigatkedk
    qriseilqetwesaddwfvse