PDB entry 1ejj

View 1ejj on RCSB PDB site
Description: crystal structural analysis of phosphoglycerate mutase cocrystallized with 3-phosphoglycerate
Class: isomerase
Keywords: alpha/beta-type structure, ISOMERASE
Deposited on 2000-03-02, released 2001-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate mutase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X519
      • see remark 999 (350)
    Domains in SCOPe 2.07: d1ejja1, d1ejja2
  • Heterogens: MN, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ejjA (A:)
    mskkpvaliildgfalrdetygnavaqankpnfdrywneyphttlkacgeavglpegqmg
    nsevghlnigagrivyqsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdg
    gvhshihhlyallrlaakegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeia
    tlsgryysmdrdkrwdrvekayramvygegptyrdpleciedsykhgiydefvlpsvivr
    edgrpvatiqdndaiifynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfse
    tvagyvafkptnldntigevlsqhglrqlriaetekyphvtffmsggreeefpgedrili
    nspkvptydlkpemsayevtdallkeieadkydaiilnyanpdmvghsgkleptikavea
    vdeclgkvvdailakggiaiitadhgnadevltpdgkpqtahttnpvpvivtkkgiklrd
    ggilgdlaptmldllglpqpkemtgkslivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejjA (A:)
    kkpvaliildgfalrdetygnavaqankpnfdrywneyphttlkacgeavglpegqmgns
    evghlnigagrivyqsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdggv
    hshihhlyallrlaakegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeiatl
    sgryysmdrdkrwdrvekayramvygegptyrdpleciedsykhgiydefvlpsvivred
    grpvatiqdndaiifynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfsetv
    agyvafkptnldntigevlsqhglrqlriaetekyphvtffmsggreeefpgedrilins
    pkvptydlkpemsayevtdallkeieadkydaiilnyanpdmvghsgkleptikaveavd
    eclgkvvdailakggiaiitadhgnadevltpdgkpqtahttnpvpvivtkkgiklrdgg
    ilgdlaptmldllglpqpkemtgksliv