PDB entry 1eji

View 1eji on RCSB PDB site
Description: recombinant serine hydroxymethyltransferase (mouse)
Class: transferase
Keywords: serine-glycine conversion, pyridoxal 5'-phosphate, tetrahydrofolate, asymmetric dimer, transferase
Deposited on 2000-03-02, released 2000-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.271
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejia_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejib_
  • Chain 'C':
    Compound: serine hydroxymethyltransferase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejic_
  • Chain 'D':
    Compound: serine hydroxymethyltransferase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejid_
  • Heterogens: PLG, THF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejiA (A:)
    madrdatlwashekmlsqplkdsdaevysiikkesnrqrvgleliasenfasravlealg
    sslnnkysegypgqryyggtefidelemlcqkralqayhldpqcwgvnvqpysgspanfa
    vytalvephgrimgldlpdgghlthgfmtdkkkisatsiffesmpykvypetgyinydql
    eenaslfhpkliiagtscysrnldyarlrkiaddngaylmadmahisglvaagvvpspfe
    hchvvtttthktlrgcragmifyrkgvrsvdpktgketyyeleslinsavfpglqggphn
    haiagvavalkqamttefkiyqlqvlancralsdaltelgykivtggsdnhlilmdlrsk
    gtdggraekvleacsiacnkntcpgdksalrpsglrlgtpaltsrglleedfqkvahfih
    rgieltlqiqshmatkatlkefkeklagdekiqsavatlreevenfasnfslpglpdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejiB (B:)
    madrdatlwashekmlsqplkdsdaevysiikkesnrqrvgleliasenfasravlealg
    sslnnkysegypgqryyggtefidelemlcqkralqayhldpqcwgvnvqpysgspanfa
    vytalvephgrimgldlpdgghlthgfmtdkkkisatsiffesmpykvypetgyinydql
    eenaslfhpkliiagtscysrnldyarlrkiaddngaylmadmahisglvaagvvpspfe
    hchvvtttthktlrgcragmifyrkgvrsvdpktgketyyeleslinsavfpglqggphn
    haiagvavalkqamttefkiyqlqvlancralsdaltelgykivtggsdnhlilmdlrsk
    gtdggraekvleacsiacnkntcpgdksalrpsglrlgtpaltsrglleedfqkvahfih
    rgieltlqiqshmatkatlkefkeklagdekiqsavatlreevenfasnfslpglpdf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejiC (C:)
    madrdatlwashekmlsqplkdsdaevysiikkesnrqrvgleliasenfasravlealg
    sslnnkysegypgqryyggtefidelemlcqkralqayhldpqcwgvnvqpysgspanfa
    vytalvephgrimgldlpdgghlthgfmtdkkkisatsiffesmpykvypetgyinydql
    eenaslfhpkliiagtscysrnldyarlrkiaddngaylmadmahisglvaagvvpspfe
    hchvvtttthktlrgcragmifyrkgvrsvdpktgketyyeleslinsavfpglqggphn
    haiagvavalkqamttefkiyqlqvlancralsdaltelgykivtggsdnhlilmdlrsk
    gtdggraekvleacsiacnkntcpgdksalrpsglrlgtpaltsrglleedfqkvahfih
    rgieltlqiqshmatkatlkefkeklagdekiqsavatlreevenfasnfslpglpdf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejiD (D:)
    madrdatlwashekmlsqplkdsdaevysiikkesnrqrvgleliasenfasravlealg
    sslnnkysegypgqryyggtefidelemlcqkralqayhldpqcwgvnvqpysgspanfa
    vytalvephgrimgldlpdgghlthgfmtdkkkisatsiffesmpykvypetgyinydql
    eenaslfhpkliiagtscysrnldyarlrkiaddngaylmadmahisglvaagvvpspfe
    hchvvtttthktlrgcragmifyrkgvrsvdpktgketyyeleslinsavfpglqggphn
    haiagvavalkqamttefkiyqlqvlancralsdaltelgykivtggsdnhlilmdlrsk
    gtdggraekvleacsiacnkntcpgdksalrpsglrlgtpaltsrglleedfqkvahfih
    rgieltlqiqshmatkatlkefkeklagdekiqsavatlreevenfasnfslpglpdf