PDB entry 1ejh

View 1ejh on RCSB PDB site
Description: eif4e/eif4g peptide/7-methyl-gdp
Deposited on 2000-03-02, released 2000-03-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ejha_
  • Chain 'B':
    Domains in SCOP 1.55: d1ejhb_
  • Chain 'C':
    Domains in SCOP 1.55: d1ejhc_
  • Chain 'D':
    Domains in SCOP 1.55: d1ejhd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ejhA (A:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgstt
    knrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejhA (A:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrfvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ejhB (B:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgstt
    knrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejhB (B:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrfvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ejhC (C:)
    pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
    yslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvc
    gavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgst
    tknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejhC (C:)
    pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
    yslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvc
    gavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrfv
    v
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ejhD (D:)
    ikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslf
    kdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgavv
    nvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgsttknr
    fvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejhD (D:)
    ikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslf
    kdgiepmwedeknkrggrwlitlnsdldrfwletllcligesfddysddvcgavvnvrak
    gdkiaiwttecenrdavthigrvykerlglppkivigyqshadtnrfvv