PDB entry 1ejh

View 1ejh on RCSB PDB site
Description: eif4e/eif4g peptide/7-methyl-GDP
Class: translation
Keywords: eIF4E/eIF4GII peptide/7-methyl-GDP, TRANSLATION
Deposited on 2000-03-02, released 2000-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejha_
  • Chain 'B':
    Compound: eukaryotic initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejhb_
  • Chain 'C':
    Compound: eukaryotic initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejhc_
  • Chain 'D':
    Compound: eukaryotic initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejhd_
  • Chain 'E':
    Compound: eukaryotic initiation factor 4gii
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAC02903 (0-End)
  • Chain 'F':
    Compound: eukaryotic initiation factor 4gii
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAC02903 (0-15)
  • Chain 'G':
    Compound: eukaryotic initiation factor 4gii
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAC02903 (0-End)
  • Chain 'H':
    Compound: eukaryotic initiation factor 4gii
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAC02903
  • Heterogens: M7G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ejhA (A:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejhA (A:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrfvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ejhB (B:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejhB (B:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrfvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ejhC (C:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejhC (C:)
    pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
    yslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvc
    gavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrfv
    v
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ejhD (D:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejhD (D:)
    ikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslf
    kdgiepmwedeknkrggrwlitlnsdldrfwletllcligesfddysddvcgavvnvrak
    gdkiaiwttecenrdavthigrvykerlglppkivigyqshadtnrfvv
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.