PDB entry 1ejf

View 1ejf on RCSB PDB site
Description: crystal structure of the human co-chaperone p23
Class: chaperone
Keywords: Chaperone, Co-Chaperone, Beta-Sandwich
Deposited on 2000-03-02, released 2000-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.236
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor p23
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejfa_
  • Chain 'B':
    Compound: progesterone receptor p23
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ejfb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ejfA (A:)
    mqpasakwydrrdyvfiefcvedskdvnvnfekskltfsclggsdnfkhlneidlfhcid
    pndskhkrtdrsilcclrkgesgqswprltkeraklnwlsvdfnnwkdweddsdedmsnf
    drfse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejfA (A:)
    mqpasakwydrrdyvfiefcvedskdvnvnfekskltfsclggsdnfkhlneidlfhcid
    pndskhkrtdrsilcclrkgesgqswprltkeraklnwlsvdfnnwkdwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ejfB (B:)
    mqpasakwydrrdyvfiefcvedskdvnvnfekskltfsclggsdnfkhlneidlfhcid
    pndskhkrtdrsilcclrkgesgqswprltkeraklnwlsvdfnnwkdweddsdedmsnf
    drfse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejfB (B:)
    mqpasakwydrrdyvfiefcvedskdvnvnfekskltfsclggsdnfkhlneidlfhcid
    pndskhkrtdrsilcclrkgesgqswprltkeraklnwlsvdfnnwkdwe