PDB entry 1eje

View 1eje on RCSB PDB site
Description: crystal structure of an fmn-binding protein
Class: ligand binding protein
Keywords: FMN-Binding Protein, structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, LIGAND BINDING PROTEIN
Deposited on 2000-03-02, released 2000-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fmn-binding protein
  Species: Methanothermobacter thermautotrophicus [TaxId:145262]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O26255 (6-191)
    • see remark 999 (0-5)
  Domains in SCOPe 2.08: d1ejea_
• Heterogens: NI, SO4, FMN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ejeA (A:)
  gsqaahmmsmdfedfpvesahriltprptvmvttvdeegninaapfsftmpvsidppvva
  fasapdhhtarniesthefvinitpadiiermwvtardipageneleaaglawtssrrvk
  ppriveapghlecellrmfevgdhnlitgsvvsasvrsgavkeglldvesvkpvlhvggn
  kfvvgdhvrhve