PDB entry 1eje

View 1eje on RCSB PDB site
Description: crystal structure of an fmn-binding protein
Class: ligand binding protein
Keywords: FMN-Binding Protein, structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, LIGAND BINDING PROTEIN
Deposited on 2000-03-02, released 2000-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.225
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fmn-binding protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26255 (6-191)
      • see remark 999 (0-5)
    Domains in SCOPe 2.07: d1ejea_
  • Heterogens: NI, SO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejeA (A:)
    gsqaahmmsmdfedfpvesahriltprptvmvttvdeegninaapfsftmpvsidppvva
    fasapdhhtarniesthefvinitpadiiermwvtardipageneleaaglawtssrrvk
    ppriveapghlecellrmfevgdhnlitgsvvsasvrsgavkeglldvesvkpvlhvggn
    kfvvgdhvrhve