PDB entry 1ejc

View 1ejc on RCSB PDB site
Description: Crystal structure of unliganded mura (type2)
Class: transferase
Keywords: inside-out alpha/beta barrel, TRANSFERASE
Deposited on 2000-03-02, released 2000-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine enolpyruvyltransferase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33038 (0-418)
      • conflict (66)
    Domains in SCOPe 2.07: d1ejca_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejcA (A:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge