PDB entry 1ej9

View 1ej9 on RCSB PDB site
Description: crystal structure of human topoisomerase I DNA complex
Class: isomerase/DNA
Keywords: protein-dna complex, type I topoisomerase, human, ISOMERASE/DNA COMPLEX
Deposited on 2000-03-01, released 2000-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (0-562)
      • engineered (520)
    Domains in SCOPe 2.07: d1ej9a1, d1ej9a2
  • Chain 'C':
    Compound: DNA (5'-d(*c*ap*ap*ap*ap*ap*gp*ap*cp*tp*cp*ap*gp*ap*ap*ap*ap*ap*tp*tp*tp*tp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*c*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*tp*gp*ap*gp*tp*cp*tp*tp*tp*tp*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ej9A (A:)
    wkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffak
    mldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmske
    eklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpedi
    iincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwq
    kyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadtv
    gccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqped
    dlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynra
    nravailcnhqiappktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkk
    vveskkkavqrleeqlmklevqatdreenkqialgtsklnfldpritvawckkwgvpiek
    iynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej9A (A:)
    wkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffak
    mldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmske
    eklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpedi
    iincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwq
    kyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadtv
    gccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqped
    dlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynra
    nravailcnhqialgtsklnfldpritvawckkwgvpiekiynktqrekfawaidmaded
    yef
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.