PDB entry 1ej8

View 1ej8 on RCSB PDB site
Description: crystal structure of domain 2 of the yeast copper chaperone for superoxide dismutase (lys7) at 1.55 a resolution
Class: chaperone
Keywords: beta barrel, copper chaperone for SOD, domain 2
Deposited on 2000-03-01, released 2000-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.196
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lys7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ej8a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej8A (A:)
    ssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasihekg
    dvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvisksln
    hpenepssvkdysflgviar