PDB entry 1ej6

View 1ej6 on RCSB PDB site
Description: Reovirus core
Class: virus
Keywords: virus, icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, Icosahedral virus
Deposited on 2000-02-29, released 2000-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lambda2
    Species: Reovirus sp. [TaxId:10891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej6a_
  • Chain 'B':
    Compound: lambda1
    Species: Reovirus sp. [TaxId:10891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej6b_
  • Chain 'C':
    Compound: lambda1
    Species: Reovirus sp. [TaxId:10891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej6c_
  • Chain 'D':
    Compound: sigma2
    Species: Reovirus sp. [TaxId:10891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej6d_
  • Chain 'E':
    Compound: sigma2
    Species: Reovirus sp. [TaxId:10891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej6e_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ej6A (A:)
    manvwgvrladslssptietrtrqytlhdlcsdldanpgrepwkplrnqrtnnivavqlf
    rplqglvldtqlygfpgafddwerfmreklrvlkyevlriypisnysnehvnvfvanalv
    gaflsnqafydllplliindtmigdllgtgaslsqffqshgdvlevaagrkylqmenysn
    ddddpplfakdlsdyakafysdtyevldrffwthdssagvlvhydkptnghhyllgtltq
    mvsappyiinatdamllescleqfsanvrarpaqpvtrldqcyhlrwgaqyvgedsltyr
    lgvlsllatngyqlarpiprqltnrwlssfvsqimsdgvnetplwpqeryvqiaydspsv
    vdgatqygyvrknqlrlgmrisalqslsdtpspvqwlpqytidqaamdegdlmvsrltql
    plrpdygniwvgdalsyyvdynrshrvvlsselpqlpdtyfdgdeqygrslfslarkigd
    rslvkdtavlkhayqaidpntgkeylrsrqsvayfgasaghsgadqplviepwiqgkisg
    vpppssvrqfgydvargaivdlarpfpsgdyqfvysdvdqvvdghddlsissglveslls
    scmhatapggsfvvkinfptrpvwhyieqkilpnitsymlikpfvtnnvelffvafgvhq
    hssltwtsgvyfflvdhfyryetlstisrqlpsfgyvddgssvtgietisienpgfsnmt
    qaarigisglcanvgnarksiaiyeshgarvltitsrrspasarrksrlrylplidprsl
    evqartilpadpvlfenvsgasphvcltmmynfevssavydgdvvldlgtgpeakileli
    patspvtcvdirptaqpsgcwnvrttfleldylsdgwitgvrgdivtcmlslgaaaagks
    mtfdaafqqlikvlskstanvvlvqvncptdvvrsikgyleidstnkryrfpkfgrdepy
    sdmdalekicrtawpncsitwvplsydlrwtrlallesttlssasiriaelmykympimr
    idihglpmekrgnfivgqncslvipgfnaqdvfncyfnsalafstedvnaamipqvsaqf
    datkgewtldmvfsdagiytmqalvgsnanpvslgsfvvdspdvditdawpaqldftiag
    tdvditvnpyyrlmtfvridgqwqianpdkfqffssasgtlvmnvkldiadkyllyyird
    vqsrdvgfyiqhplqllntitlptnedlflsapdmrewavkesgnticilnsqgfvlpqd
    wdvltdtiswspsiptyivppgdytltpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej6A (A:)
    anvwgvrladslssptietrtrqytlhdlcsdldanpgrepwkplrnqrtnnivavqlfr
    plqglvldtqlygfpgafddwerfmreklrvlkyevlriypisnysnehvnvfvanalvg
    aflsnqafydllplliindtmigdllgtgaslsqffqshgdvlevaagrkylqmenysnd
    dddpplfakdlsdyakafysdtyevldrffwthdssagvlvhydkptnghhyllgtltqm
    vsappyiinatdamllescleqfsanvrarpaqpvtrldqcyhlrwgaqyvgedsltyrl
    gvlsllatngyqlarpiprqltnrwlssfvsqimsdgvnetplwpqeryvqiaydspsvv
    dgatqygyvrknqlrlgmrisalqslsdtpspvqwlpqytidqaamdegdlmvsrltqlp
    lrpdygniwvgdalsyyvdynrshrvvlsselpqlpdtyfdgdeqygrslfslarkigdr
    slvkdtavlkhayqaidpntgkeylrsrqsvayfgasaghsgadqplviepwiqgkisgv
    pppssvrqfgydvargaivdlarpfpsgdyqfvysdvdqvvdghddlsissglvesllss
    cmhatapggsfvvkinfptrpvwhyieqkilpnitsymlikpfvtnnvelffvafgvhqh
    ssltwtsgvyfflvdhfyryetlstisrqlpsfgyvddgssvtgietisienpgfsnmtq
    aarigisglcanvgnarksiaiyeshgarvltitsrrspasarrksrlrylplidprsle
    vqartilpadpvlfenvsgasphvcltmmynfevssavydgdvvldlgtgpeakilelip
    atspvtcvdirptaqpsgcwnvrttfleldylsdgwitgvrgdivtcmlslgaaaagksm
    tfdaafqqlikvlskstanvvlvqvncptdvvrsikgyleidstnkryrfpkfgrdepys
    dmdalekicrtawpncsitwvplsydlrwtrlallesttlssasiriaelmykympimri
    dihglpmekrgnfivgqncslvipgfnaqdvfncyfnsalafstedvnaamipqvsaqfd
    atkgewtldmvfsdagiytmqalvgsnanpvslgsfvvdspdvditdawpaqldftiagt
    dvditvnpyyrlmtfvridgqwqianpdkfqffstlvmnvkldiadkyllyyirdvqsrd
    vgfyiqhplqllntitlptnedlflsapdmrewavkesgnticilnsqgfvlpqdwdvlt
    dtiswspsiptyivppgdytltpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ej6B (B:)
    mkriprktkgkssgkgndstersddgssqlrdkqnnkagpattepgtsnreqyrarpgia
    svqratesaelpmknndegtpdkkgntrgdlvnehseakdeadeatqkqakdtdkskaqv
    tysdtginnanelsrsgnvdneggsnqkpmstriaeatsaivskhparvglpptassghg
    yqchvcsavlfspldldahvashglhgnmtltsseiqrhitefisswqnhpivqvsadve
    nkktaqllhadtprlvtwdaglctsfkivpivpaqvpqdvlaytfftssyaiqspfpeaa
    vsrivvhtrwasnvdfdrdssvimapptennihlfkqllntetlsvrganplmfranvlh
    mllefvldnlylnrhtgfsqdhtpfteganlrslpgpdaekwysimyptrmgtpnvskic
    nfvascvrnrvgrfdraqmmngamsewvdvfetsdaltvsirgrwmarlarmninpteie
    waltecaqgyvtvtspyapsvnrlmpyrisnaerqisqiirimnignnatviqpvlqdis
    vllqrisplqidptiisntmstvsesttqtlspassilgklrpsnsdfssfrvalagwly
    ngvvttviddssypkdggsvtslenlwdffilalalplttdpcapvkafmtlanmmvgfe
    tipmdnqiytqsrrasafstphtwprcfmniqlispidapilrqwaeiihrywpnpsqir
    ygapnvfgsanlftppevlllpidhqpanvttptldftneltnwrarvcelmknlvdnqr
    yqpgwtqslvssmrgtldklkliksmtpmylqqlapvelaviapmlpfppfqvpyvrldr
    drvptmvgvtrqsrdtitqpalslsttnttvgvplaldaraitvallsgkyppdlvtnvw
    yadaiypmyadtevfsnlqrdmitceavqtlvtlvaqisetqypvdryldwipslrasaa
    taatfaewvntsmktafdlsdmllepllsgdprmtqlaiqyqqyngrtfnvipempgsvi
    adcvqltaevfnheynlfgiargdiiigrvqsthlwsplapppdlvfdrdtpgvhifgrd
    crisfgmngaapmirdetgmmvpfegnwifplalwqmntryfnqqfdawiktgelririe
    mgaypymlhyydprqyanawnltsawleeitptsipsvpfmvpissdhdissapavqyii
    steyndrslfctnssspqtiagpdkhipveryniltnpdapptqiqlpevvdlynvvtry
    ayetppitavvmgvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej6B (B:)
    nkktaqllhadtprlvtwdaglctsfkivpivpaqvpqdvlaytfftssyaiqspfpeaa
    vsrivvhtrwasnvdfdrdssvimapptennihlfkqllntetlsvrganplmfranvlh
    mllefvldnlylnrhtgfsqdhtpfteganlrslpgpdaekwysimyptrmgtpnvskic
    nfvascvrnrvgrfdraqmmngamsewvdvfetsdaltvsirgrwmarlarmninpteie
    waltecaqgyvtvtspyapsvnrlmpyrisnaerqisqiirimnignnatviqpvlqdis
    vllqrisplqidptiisntmstvsesttqtlspassilgklrpfssfrvalagwlyngvv
    ttviddssypkdggsvtslenlwdffilalalplttdpcapvkafmtlanmmvgfetipm
    dnqiytqsrrasafstphtwprcfmniqlispidapilrqwaeiihrywpnpsqirygap
    nvfgsanlftppevlllpidhqpanvttptldftneltnwrarvcelmknlvdnqryqpg
    wtqslvssmrgtldklkliksmtpmylqqlapvelaviapmlpfppfqvpyvrldrdrvp
    tmvgvtrqsrdtitqpalslsttnttvgvplaldaraitvallsgkyppdlvtnvwyada
    iypmyadtevfsnlqrdmitceavqtlvtlvaqisetqypvdryldwipslrasaataat
    faewvntsmktafdlsdmllepllsgdprmtqlaiqyqqyngrtfnvipempgsviadcv
    qltaevfnheynlfgiargdiiigrvqsthlwsplapppdlvfdrdtpgvhifgrdcris
    fgmngaapmirdetgmmvpfegnwifplalwqmntryfnqqfdawiktgelririemgay
    pymlhyydprqyanawnltsawleeitptsipsvpfmvpissdhdissapavqyiistey
    ndrslfctnssspqtiagpdkhipveryniltnpdapptqiqlpevvdlynvvtryayet
    ppitavvmgvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ej6C (C:)
    mkriprktkgkssgkgndstersddgssqlrdkqnnkagpattepgtsnreqyrarpgia
    svqratesaelpmknndegtpdkkgntrgdlvnehseakdeadeatqkqakdtdkskaqv
    tysdtginnanelsrsgnvdneggsnqkpmstriaeatsaivskhparvglpptassghg
    yqchvcsavlfspldldahvashglhgnmtltsseiqrhitefisswqnhpivqvsadve
    nkktaqllhadtprlvtwdaglctsfkivpivpaqvpqdvlaytfftssyaiqspfpeaa
    vsrivvhtrwasnvdfdrdssvimapptennihlfkqllntetlsvrganplmfranvlh
    mllefvldnlylnrhtgfsqdhtpfteganlrslpgpdaekwysimyptrmgtpnvskic
    nfvascvrnrvgrfdraqmmngamsewvdvfetsdaltvsirgrwmarlarmninpteie
    waltecaqgyvtvtspyapsvnrlmpyrisnaerqisqiirimnignnatviqpvlqdis
    vllqrisplqidptiisntmstvsesttqtlspassilgklrpsnsdfssfrvalagwly
    ngvvttviddssypkdggsvtslenlwdffilalalplttdpcapvkafmtlanmmvgfe
    tipmdnqiytqsrrasafstphtwprcfmniqlispidapilrqwaeiihrywpnpsqir
    ygapnvfgsanlftppevlllpidhqpanvttptldftneltnwrarvcelmknlvdnqr
    yqpgwtqslvssmrgtldklkliksmtpmylqqlapvelaviapmlpfppfqvpyvrldr
    drvptmvgvtrqsrdtitqpalslsttnttvgvplaldaraitvallsgkyppdlvtnvw
    yadaiypmyadtevfsnlqrdmitceavqtlvtlvaqisetqypvdryldwipslrasaa
    taatfaewvntsmktafdlsdmllepllsgdprmtqlaiqyqqyngrtfnvipempgsvi
    adcvqltaevfnheynlfgiargdiiigrvqsthlwsplapppdlvfdrdtpgvhifgrd
    crisfgmngaapmirdetgmmvpfegnwifplalwqmntryfnqqfdawiktgelririe
    mgaypymlhyydprqyanawnltsawleeitptsipsvpfmvpissdhdissapavqyii
    steyndrslfctnssspqtiagpdkhipveryniltnpdapptqiqlpevvdlynvvtry
    ayetppitavvmgvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej6C (C:)
    mkriprktkgkspattepgtsnreqyrarpgiasvqratesaelpmknndegtpdkkgnt
    rgdlvnehseakdeadeatqkqakdtdkskaqvtysdtginnanelsrsgnvdneggsnq
    kpmstriaeatsaivskhpayqchvcsavlfspldldahvashglhgneiqrhitefiss
    wqnhpivqvsadvenkktaqllhadtprlvtwdaglctsfkivpivpaqvpqdvlaytff
    tssyaiqspfpeaavsrivvhtrwasnvdfdrdssvimapptennihlfkqllntetlsv
    rganplmfranvlhmllefvldnlylnrhtgfsqdhtpfteganlrslpgpdaekwysim
    yptrmgtpnvskicnfvascvrnrvgrfdraqmmngamsewvdvfetsdaltvsirgrwm
    arlarmninpteiewaltecaqgyvtvtspyapsvnrlmpyrisnaerqisqiirimnig
    nnatviqpvlqdisvllqrisplqidptiisntmstlspassilgklrpsnsdfssfrva
    lagwlyngvvttviddssypkdggsvtslenlwdffilalalplttdpcapvkafmtlan
    mmvgfetipmdnqiytqsrrasafstphtwprcfmniqlispidapilrqwaeiihrywp
    npsqirygapnvfgsanlftppevlllpidhqpanvttptldftneltnwrarvcelmkn
    lvdnqryqpgwtqslvssmrgtldklkliksmtpmylqqlapvelaviapmlpfppfqvp
    yvrldrdrvptmvgvtrqsrdtitqpalslsttnttvgvplaldaraitvallsgkyppd
    lvtnvwyadaiypmyadtevfsnlqrdmitceavqtlvtlvaqisetqypvdryldwips
    lrasaataatfaewvntsmktafdlsdmllepllsgdprmtqlaiqyqqyngrtfnvipe
    mpgsviadcvqltaevfnheynlfgiargdiiigrvqsthlwsplapppdlvfdrdtpgv
    hifgrdcrisfgmngaapmirdetgmmvpfegnwifplalwqmntryfnqqfdawiktge
    lririemgaypymlhyydprqyanawnltsawleeitptsipsvpfmvpissdhdissap
    avqyiisteyndrslfctnssspqtiagpdkhipveryniltnpdapptqiqlpevvdly
    nvvtryayetppitavvmgvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ej6D (D:)
    maraaflfktvgfgglqnvpindelsshllragnspwqltqfldwislgrglatsalvpt
    agsryyqmscllsgtlqipfrpnhrwgdirflrlvwsaptldglvvappqvlaqpalqaq
    adrvydcddypflardprfkhrvyqqlsavtllnltgfgpisyvrvdedmwsgdvnqllm
    nyfghtfaeiaytlcqasanrpwehdgtyarmtqiilslfwlsyvgvihqqntyrtfyfq
    cnrrgdaaevwilscslnhsaqirpgnrslfvmptspdwnmdvnlilsstltgclcsgsq
    lplidnnsvpavsrnihgwtgragnqlhgfqvrrmvtefcdrlrrdgvmtqaqqnqieal
    adqtqqfkrdkleawareddqynqanpnstmfrtkpftnaqwgrgntgatsaaiaali
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej6D (D:)
    araaflfktvgfgglqnvpindelsshllragnspwqltqfldwislgrglatsalvpta
    gsryyqmscllsgtlqipfrpnhrwgdirflrlvwsaptldglvvappqvlaqpalqaqa
    drvydcddypflardprfkhrvyqqlsavtllnltgfgpisyvrvdedmwsgdvnqllmn
    yfghtfaeiaytlcqasanrpwehdgtyarmtqiilslfwlsyvgvihqqntyrtfyfqc
    nrrgdaaevwilscslnhsaqirpgnrslfvmptspdwnmdvnlilsstltgclcsgsql
    plidnnsvpavsrnihgwtgragnqlhgfqvrrmvtefcdrlrrdgvmtqaqqnqieala
    dqtqqfkrdkleawareddqynqanpnstmfrtkpftnaqwgrgntgatsaaiaali
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ej6E (E:)
    maraaflfktvgfgglqnvpindelsshllragnspwqltqfldwislgrglatsalvpt
    agsryyqmscllsgtlqipfrpnhrwgdirflrlvwsaptldglvvappqvlaqpalqaq
    adrvydcddypflardprfkhrvyqqlsavtllnltgfgpisyvrvdedmwsgdvnqllm
    nyfghtfaeiaytlcqasanrpwehdgtyarmtqiilslfwlsyvgvihqqntyrtfyfq
    cnrrgdaaevwilscslnhsaqirpgnrslfvmptspdwnmdvnlilsstltgclcsgsq
    lplidnnsvpavsrnihgwtgragnqlhgfqvrrmvtefcdrlrrdgvmtqaqqnqieal
    adqtqqfkrdkleawareddqynqanpnstmfrtkpftnaqwgrgntgatsaaiaali
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej6E (E:)
    araaflfktvgfgglqnvpindelsshllragnspwqltqfldwislgrglatsalvpta
    gsryyqmscllsgtlqipfrpnhrwgdirflrlvwsaptldglvvappqvlaqpalqaqa
    drvydcddypflardprfkhrvyqqlsavtllnltgfgpisyvrvdedmwsgdvnqllmn
    yfghtfaeiaytlcqasanrpwehdgtyarmtqiilslfwlsyvgvihqqntyrtfyfqc
    nrrgdaaevwilscslnhsaqirpgnrslfvmptspdwnmdvnlilsstltgclcsgsql
    plidnnsvpavsrnihgwtgragnqlhgfqvrrmvtefcdrlrrdgvmtqaqqnqieala
    dqtqqfkrdkleawareddqynqanpnstmfrtkpftnaqwgrgntgatsaaiaali