PDB entry 1ej5

View 1ej5 on RCSB PDB site
Description: solution structure of the autoinhibited conformation of wasp
Deposited on 2000-02-29, released 2000-04-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ej5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej5A (A:)
    sgfkhvshvgwdpqngfdvnnldpdlrslfsragiseaqltdaetskliydfiedqggle
    avrqemrrqggsggsqsseglvgalmhvmqkrsraihssdegedqag