PDB entry 1ej5

View 1ej5 on RCSB PDB site
Description: solution structure of the autoinhibited conformation of wasp
Class: blood clotting
Keywords: alpha helix, beta-hairpin turn, BLOOD CLOTTING
Deposited on 2000-02-29, released 2000-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: wiskott-aldrich syndrome protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42768 (75-106)
      • see remark 999 (69-74)
    Domains in SCOPe 2.08: d1ej5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej5A (A:)
    sgfkhvshvgwdpqngfdvnnldpdlrslfsragiseaqltdaetskliydfiedqggle
    avrqemrrqggsggsqsseglvgalmhvmqkrsraihssdegedqag