PDB entry 1ej4

View 1ej4 on RCSB PDB site
Description: cocrystal structure of eif4e/4e-bp1 peptide
Deposited on 2000-02-29, released 2000-03-15
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ej4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ej4A (A:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgstt
    knrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej4A (A:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatnrfvv