PDB entry 1ej4

View 1ej4 on RCSB PDB site
Description: cocrystal structure of eif4e/4e-bp1 peptide
Class: translation
Keywords: eIF4E/4E-BP/7-methyl-GDP, TRANSLATION
Deposited on 2000-02-29, released 2000-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.219
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej4a_
  • Chain 'B':
    Compound: eukaryotic translation initiation factor 4e binding protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_004086 (0-13)
  • Heterogens: M7G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ej4A (A:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej4A (A:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatnrfvv
    

  • Chain 'B':
    No sequence available.