PDB entry 1ej3

View 1ej3 on RCSB PDB site
Description: crystal structure of aequorin
Class: oxidoreductase
Keywords: four EF-hand calcium-binding protein, protein-coelenterazine peroxide complex, OXIDOREDUCTASE
Deposited on 2000-02-29, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aequorin
    Species: Aequorea aequorea [TaxId:168712]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej3a_
  • Chain 'B':
    Compound: aequorin
    Species: Aequorea aequorea [TaxId:168712]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej3b_
  • Heterogens: CZH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ej3A (A:)
    anskltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrh
    kdaveaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdk
    dqngaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdp
    aceklyggavp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej3A (A:)
    ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
    eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
    aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
    lyggavp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ej3B (B:)
    anskltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrh
    kdaveaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdk
    dqngaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdp
    aceklyggavp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej3B (B:)
    ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
    eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
    aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
    lyggavp