PDB entry 1ej2

View 1ej2 on RCSB PDB site
Description: Crystal structure of methanobacterium thermoautotrophicum nicotinamide mononucleotide adenylyltransferase with bound NAD+
Class: transferase
Keywords: DINUCLEOTIDE BINDING FOLD, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Northeast Structural Genomics Consortium, NESG, TRANSFERASE
Deposited on 2000-02-29, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.211
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinamide mononucleotide adenylyltransferase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej2a_
  • Heterogens: SO4, NA, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ej2A (A:)
    mmtmrgllvgrmqpfhrghlqviksileevdeliicigsaqlshsirdpftagervmmlt
    kalsengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevt
    applfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhlakkevselggi
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej2A (A:)
    mrgllvgrmqpfhrghlqviksileevdeliicigsaqlshsirdpftagervmmltkal
    sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp
    lfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhla