PDB entry 1ej1

View 1ej1 on RCSB PDB site
Description: cocrystal structure of the messenger rna 5' cap-binding protein (eif4e) bound to 7-methyl-gdp
Deposited on 2000-02-29, released 2000-03-15
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ej1a_
  • Chain 'B':
    Domains in SCOP 1.57: d1ej1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ej1A (A:)
    khplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslfk
    dgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgavvn
    vrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgsttknrf
    vv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ej1A (A:)
    khplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslfk
    dgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgavvn
    vrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksknrfvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej1B (B:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv