PDB entry 1ej0

View 1ej0 on RCSB PDB site
Description: ftsj RNA methyltransferase complexed with s-adenosylmethionine, mercury derivative
Class: transferase
Keywords: ftsj, methyltransferase, adomet, adenosyl methionine, heat shock proteins, 23S RIBOSOMAL RNA, TRANSFERASE
Deposited on 2000-02-29, released 2000-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ftsj
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ej0a_
  • Heterogens: HG, SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej0A (A:)
    glrsrawfkldeiqqsdklfkpgmtvvdlgaapggwsqyvvtqiggkgriiacdllpmdp
    ivgvdflqgdfrdelvmkallervgdskvqvvmsdmapnmsgtpavdipramylvelale
    mcrdvlapggsfvvkvfqgegfdeylreirslftkvkvrkpdssrarsrevyivatgrkp