PDB entry 1eiy

View 1eiy on RCSB PDB site
Description: the crystal structure of phenylalanyl-tRNA synthetase from thermus thermophilus complexed with cognate trnaphe
Class: ligase/RNA
Keywords: aminoacyl-tRNA synthetase, tRNA recognition, LIGASE-RNA COMPLEX
Deposited on 2000-02-29, released 2000-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.221
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eiya1, d1eiya2
  • Chain 'B':
    Compound: phenylalanyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6
  • Chain 'C':
    Compound: tRNA(phe)
    Species: Thermus thermophilus [TaxId:300852]
    Gene:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eiyA (A:)
    mleealaaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaa
    leaalearekaleeaalkealerervdvslpgaslfsgglhpitlmerelveifralgyq
    avegpeveseffnfdalnipehhpardmwdtfwltgegfrlegplgeevegrlllrthts
    pmqvrymvahtppfrivvpgrvfrfeqtdatheavfhqleglvvgegiamahlkgaiyel
    aqalfgpdskvrfqpvyfpfvepgaqfavwwpeggkwlelggagmvhpkvfqavdayrer
    lglppayrgvtgfafglgverlamlrygipdiryffggrlkfleqfkgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eiyA (A:)
    laaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaaleaal
    earekaleeaalkealerervdvslpgaslfsgglhpitlmerelveifralgyqavegp
    eveseffnfdalnipehhpardmwdtfwltgegfrlegplgeevegrlllrthtspmqvr
    ymvahtppfrivvpgrvfrfeqtdatheavfhqleglvvgegiamahlkgaiyelaqalf
    gpdskvrfqpvyfpfvepgaqfavwwpeggkwlelggagmvhpkvfqavdayrerlglpp
    ayrgvtgfafglgverlamlrygipdiryffggrlkfleqfkgvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eiyB (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariqgyetiplalpaff
    papdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrargfglr
    gldtp
    

  • Chain 'C':
    No sequence available.