PDB entry 1eiy

View 1eiy on RCSB PDB site
Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe
Deposited on 2000-02-29, released 2000-03-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-26, with a file datestamp of .
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.221
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eiyA (A:)
    laaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaaleaal
    earekaleeaalkealerervdvslpgaslfsgglhpitlmerelveifralgyqavegp
    eveseffnfdalnipehhpardmwdtfwltgegfrlegplgeevegrlllrthtspmqvr
    ymvahtppfrivvpgrvfrfeqtdatheavfhqleglvvgegiamahlkgaiyelaqalf
    gpdskvrfqpvyfpfvepgaqfavwwpeggkwlelggagmvhpkvfqavdayrerlglpp
    ayrgvtgfafglgverlamlrygipdiryffggrlkfleqfkgvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eiyB (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariqgyetiplalpaff
    papdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrargfglr
    gldtp