PDB entry 1eix

View 1eix on RCSB PDB site
Description: structure of orotidine 5'-monophosphate decarboxylase from e. coli, co-crystallised with the inhibitor bmp
Class: lyase
Keywords: alpha-beta-barrel, protein-inhibitor complex, homodimer, LYASE
Deposited on 2000-02-29, released 2000-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eixa_
  • Chain 'B':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eixb_
  • Chain 'C':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eixc_
  • Chain 'D':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eixd_
  • Heterogens: BMQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eixA (A:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eixA (A:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eixB (B:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eixB (B:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eixC (C:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eixC (C:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslqr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eixD (D:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eixD (D:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq