PDB entry 1eiw

View 1eiw on RCSB PDB site
Description: Solution structure of hypothetical protein MTH538 from Methanobacterium thermoautotrophicum
Class: structural genomics
Keywords: CheY-like fold, flavodoxin-like fold, (a/b)5 doubly wound fold, parallel beta sheet, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2000-02-29, released 2000-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein mth538
  Species: Methanothermobacter thermautotrophicus [TaxId:145262]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O26638 (0-110)
    • conflict (0)
  Domains in SCOPe 2.08: d1eiwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eiwA (A:)
  vtaeirlyitegevedyrvflerleqsglewrpatpedadavivlaglwgtrrdeilgav
  dlarksskpiitvrpyglenvppeleavssevvgwnphcirdaledaldvi