PDB entry 1eit

View 1eit on RCSB PDB site
Description: nmr study of mu-agatoxin
Class: neurotoxin
Keywords: neurotoxin, excitatory insect toxin
Deposited on 1995-12-14, released 1996-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mu-agatoxin-I
  Species: Agelenopsis aperta [TaxId:6908]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11057 (0-35)
  Domains in SCOPe 2.08: d1eita_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eitA (A:)
  ecvpenghcrdwydeccegfycscrqppkcicrnnn