PDB entry 1eis

View 1eis on RCSB PDB site
Description: uda uncomplexed form. crystal structure of urtica dioica agglutinin, a superantigen presented by MHC molecules of class I and class II
Class: sugar binding protein
Keywords: lectin, hevein domain, uda, superantigen, sugar binding protein
Deposited on 2000-02-28, released 2000-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (agglutinin isolectin vi/agglutinin isolectin v)
    Species: Urtica dioica [TaxId:3501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SYR5 (0-End)
      • conflict (0)
      • microheterogeneity (9)
    Domains in SCOPe 2.07: d1eisa1, d1eisa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eisA (A:)
    ercgsqgggstcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggncqyrcsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eisA (A:)
    ercgsqgggstcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggncqyrc