PDB entry 1eis

View 1eis on RCSB PDB site
Description: uda uncomplexed form. crystal structure of urtica dioica agglutinin, a superantigen presented by mhc molecules of class i and class ii
Deposited on 2000-02-28, released 2000-06-21
The last revision prior to the SCOP 1.71 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.207
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eisA (A:)
    ercgsqgggstcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggncqyrcsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eisA (A:)
    ercgsqgggstcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggncqyrc