PDB entry 1eis

View 1eis on RCSB PDB site
Description: uda uncomplexed form. crystal structure of urtica dioica agglutinin, a superantigen presented by MHC molecules of class I and class II
Class: sugar binding protein
Keywords: lectin, hevein domain, uda, superantigen, sugar binding protein
Deposited on 2000-02-28, released 2000-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (agglutinin isolectin vi/agglutinin isolectin v)
  Species: Urtica dioica [TaxId:3501]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9SYR5 (0-End)
    • microheterogeneity (9)
  Domains in SCOPe 2.08: d1eisa1, d1eisa2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1eisA (A:)
  ercgsqgggstcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
  drccsvhgwcgggndycsggncqyrcsss
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1eisA (A:)
  ercgsqgggstcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
  drccsvhgwcgggndycsggncqyrc