PDB entry 1eir

View 1eir on RCSB PDB site
Description: 2,3-dihydroxybiphenyl-1,2-dioxygenase
Class: oxidoreductase
Keywords: four repetitions of beta-alpha-beta-beta-beta motifs, OXIDOREDUCTASE
Deposited on 2000-02-28, released 2001-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-dihydroxybiphenyl-1,2-dioxygenase
    Species: Pseudomonas sp. [TaxId:307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eira1, d1eira2
  • Heterogens: FE, BPY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eirA (A:)
    sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
    yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
    eifhepflpsapvsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpet
    svpahflhcngrhhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrh
    tndqtlsfyadtpspmievefgwgprtvdsswtvarhsrtamwghksvrgqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eirA (A:)
    sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
    yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
    eifhepflpsapvsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpet
    svpahflhcngrhhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrh
    tndqtlsfyadtpspmievefgwgprtvdsswtvarhsrtamwghksvr