PDB entry 1eip

View 1eip on RCSB PDB site
Description: the structure of e. coli soluble pyrophosphatase at 2.7 angstroms resolution
Deposited on 1994-03-29, released 1994-08-31
The last revision was dated 1994-08-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1eipA (A:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

    Sequence, based on observed residues (ATOM records):
    >1eipA (A:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtedaklvavphsklskeydhikdvn
    dlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1eipB (B:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

    Sequence, based on observed residues (ATOM records):
    >1eipB (B:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtedaklvavphsklskeydhikdvn
    dlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak