PDB entry 1eik

View 1eik on RCSB PDB site
Description: Solution Structure of RNA Polymerase Subunit RPB5 from Methanobacterium Thermoautotrophicum
Class: transferase
Keywords: rpb5, rpbH, rna polymerase subunit, OCSP, NESG, PROTEIN STRUCTURE INITIATIVE, Structural Genomics, PSI, Northeast Structural Genomics Consortium, TRANSFERASE
Deposited on 2000-02-25, released 2000-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA polymerase subunit rpb5
  Species: Methanothermobacter thermautotrophicus [TaxId:145262]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27122 (0-76)
  Domains in SCOPe 2.08: d1eika_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eikA (A:)
  mkreilkhqlvpehvilneseakrvlkeldahpeqlpkikttdpvakaigakrgdivkii
  rksptaeefvtyrlvqd