PDB entry 1eij

View 1eij on RCSB PDB site
Description: nmr ensemble of methanobacterium thermoautotrophicum protein 1615
Class: DNA binding protein
Keywords: beta-helix, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, DNA BINDING PROTEIN
Deposited on 2000-02-25, released 2000-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein mth1615
  Species: Methanothermobacter thermautotrophicus [TaxId:145262]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27652 (0-End)
  Domains in SCOPe 2.08: d1eija_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1eijA (A:)
  mrqqlemqkkqimmqiltpearsrlanlrltrpdfveqielqliqlaqmgrvrskitdeq
  lkellkrvagkkreikisrk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1eijA (A:)
  mrqqlemqkkqimmqiltpearsrlanlrltrpdfveqielqliqlaqmgrvrskitdeq
  lkellkrvagkk