PDB entry 1eii

View 1eii on RCSB PDB site
Description: nmr structure of holo cellular retinol-binding protein II
Class: transport protein
Keywords: protein-ligand complex, beta barrel, helix-turn-helix, transport protein
Deposited on 2000-02-25, released 2000-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cellular retinol-binding protein II
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06768 (0-133)
  Domains in SCOPe 2.08: d1eiia_
• Heterogens: RTL

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eiiA (A:)
  mtkdqngtwemesnenfegymkaldidfatrkiavrltqtkiivqdgdnfktktnstfrn
  ydldftvgvefdehtkgldgrnvktlvtwegntlvcvqkgekenrgwkqwvegdklylel
  tcgdqvcrqvfkkk