PDB entry 1eii

View 1eii on RCSB PDB site
Description: nmr structure of holo cellular retinol-binding protein II
Class: transport protein
Keywords: protein-ligand complex, beta barrel, helix-turn-helix, transport protein
Deposited on 2000-02-25, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellular retinol-binding protein II
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eiia_
  • Heterogens: RTL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eiiA (A:)
    mtkdqngtwemesnenfegymkaldidfatrkiavrltqtkiivqdgdnfktktnstfrn
    ydldftvgvefdehtkgldgrnvktlvtwegntlvcvqkgekenrgwkqwvegdklylel
    tcgdqvcrqvfkkk