PDB entry 1eih

View 1eih on RCSB PDB site
Description: solution structure of the human chemokine eotaxin-2
Deposited on 2000-02-25, released 2000-12-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-06, with a file datestamp of 2000-12-06.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1eiha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eihA (A:)
  vvipspccmffvskripenrvvsyqlssrstclkagvifttkkgqqscgdpkqewvqrym
  knldakqkkaspr